DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and PTF1A

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_835455.1 Gene:PTF1A / 256297 HGNCID:23734 Length:328 Species:Homo sapiens


Alignment Length:204 Identity:54/204 - (26%)
Similarity:75/204 - (36%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QPKTESISDGDGDAELSDFSLNDTEEDEE----DLRDYIVLNGNQADANRSLSSSPRSHSRNGLL 126
            |...:.:.|||   ||    |.|.:.:.|    .|.:|...:|      ..|...|...:....|
Human    30 QSSRDPLEDGD---EL----LADEQAEVEFLSHQLHEYCYRDG------ACLLLQPAPPAAPLAL 81

  Fly   127 TAPASSGSSVGGSGGGGGNGSGGNASSGG--------------------------------GSGV 159
            ..|:|.|......|||||......|..||                                |:..
Human    82 APPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAA 146

  Fly   160 GATGGVRKV-----------FTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKY 213
            .|....|:|           ..|.|||.|.|:::.||..||..:||.|.:|:|||.:.||.||.|
Human   147 AAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGY 211

  Fly   214 IKLLTGILE 222
            |..|:.:::
Human   212 INFLSELVQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)
PTF1ANP_835455.1 HLH 165..220 CDD:238036 24/54 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.