DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Tcf21

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001027569.1 Gene:Tcf21 / 252856 RGDID:620523 Length:179 Species:Rattus norvegicus


Alignment Length:144 Identity:49/144 - (34%)
Similarity:70/144 - (48%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LSDFSLNDTEEDEEDLRDYIVLNGN--QADANRSLSSSPRSHSRNGLLTAPASSGSSVGGSGGGG 143
            :|..||:|.    |||::..:|:.:  :.|:|:...:|..|....    :...:||...|.||.|
  Rat     1 MSTGSLSDV----EDLQEVEMLDCDSLKVDSNKEFGTSNESTEEG----SNCENGSPQKGRGGLG 57

  Fly   144 GNGSGGNASSGGGSGVGATG-GVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEIL 207
            .........| ..|||...| .|::...|.|||.|.:.:|.||:.|:..:|..|||.||||.:.|
  Rat    58 KRRKAPTKKS-PLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTL 121

  Fly   208 RSAIKYIKLLTGIL 221
            |.|..||..|..||
  Rat   122 RLASSYIAHLRQIL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 25/51 (49%)
Tcf21NP_001027569.1 bHLH_TS_TCF21_capsulin 77..140 CDD:381547 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.