DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and FERD3L

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens


Alignment Length:169 Identity:48/169 - (28%)
Similarity:68/169 - (40%) Gaps:53/169 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PAL-LRHATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPR 118
            ||| ||...|....:.|   :||.:.|..:....|.||:||:.|...|          ||...|:
Human    42 PALALREGRPRRMARFE---EGDPEEEECEVDQGDGEEEEEEERGRGV----------SLLGRPK 93

  Fly   119 SHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSG 183
               |..::|.                                    .::...|.|||.|..|::.
Human    94 ---RKRVITY------------------------------------AQRQAANIRERKRMFNLNE 119

  Fly   184 AFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            ||.:||:.|||...:|:||:.|.||.||.||..:|.:||
Human   120 AFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 11/43 (26%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.