DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Tal1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:357 Identity:90/357 - (25%)
Similarity:120/357 - (33%) Gaps:167/357 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGHSQTNESPRSGHLNGNGSMRDTAAGRHPPAL-------LRHATPHLQPKTESISDGDGDAELS 82
            :||::..|.|.|            .|.|..|.|       .|.|.|||                 
Mouse     2 AGHTRMTERPPS------------EAARSDPQLEGQDAAEARMAPPHL----------------- 37

  Fly    83 DFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSP-------RSHSRNGLLT------------- 127
                             ::|||...:.:|:..:.|       ||.:..|..:             
Mouse    38 -----------------VLLNGVAKETSRAAPAEPPVIELGARSGAGGGPASGGGAARDLKGRDA 85

  Fly   128 ------------------------APASSGSSVGGSG-------------GGGGNG-----SGGN 150
                                    ||||:.:.:.|.|             .|.|..     |...
Mouse    86 VAAEARLRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPL 150

  Fly   151 ASSGGG----------------------------SGVGATGGVRKVFTNTRERWRQQNVSGAFAE 187
            ||.|.|                            |....|..||::|||:|||||||||:|||||
Mouse   151 ASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAE 215

  Fly   188 LRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQA------------------------ 228
            ||||:||||||||||||||||.|:|||..|..:|..|:.:.                        
Mouse   216 LRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPVVGAGGGGAGGGIP 280

  Fly   229 PSHPIRAQMEPNNNDNRMANGHAADGENLENP 260
            |...::..:.||::.....:|.|:.....|.|
Mouse   281 PEDLLQDVLSPNSSCGSSLDGAASPDSYTEEP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 40/50 (80%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 46/63 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7447
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007786
OrthoInspector 1 1.000 - - otm43728
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5855
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.