DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and hlh-10

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_505401.2 Gene:hlh-10 / 191402 WormBaseID:WBGene00001954 Length:202 Species:Caenorhabditis elegans


Alignment Length:248 Identity:53/248 - (21%)
Similarity:86/248 - (34%) Gaps:73/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSNGADNADERSTASSGSSGHSQTNESPR--------SGHLNGN------GSMRDTAAGRHPPAL 57
            ||:...:.:|....|:|:.|:|:.::..:        ...|..|      .||.:.:|.:  |.|
 Worm     3 SSSMTTHQEEPLDLSTGNHGNSELSDEQQIMQVMESCGMFLQQNLFAWFLQSMLEASASQ--PQL 65

  Fly    58 LRHATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPRSHSR 122
            .:...|.                      |||:|:     |.:..|.::.:.....:.||..:||
 Worm    66 TQDEPPE----------------------NDTKEN-----DLVKQNKSEVNDENESTPSPTQNSR 103

  Fly   123 NGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGV--RKVFTNTRERWRQQNVSGAF 185
                                       ..:|.|.......|.:  |:...|.|||.|.|.:|..|
 Worm   104 ---------------------------RRTSTGKIDRRMVGKMCTRRYEANARERNRVQQLSKMF 141

  Fly   186 AELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQME 238
            .:||..:|.. .|.|:||...|:.|..||..|..||:...........:.|:|
 Worm   142 DQLRVCLPIE-DDAKISKLATLKVASSYIGYLGAILQENSNDEEEFKKQLQVE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 21/50 (42%)
hlh-10NP_505401.2 bHLH_SF 121..179 CDD:381792 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.