DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Nhlh2

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_848892.1 Gene:Nhlh2 / 18072 MGIID:97324 Length:135 Species:Mus musculus


Alignment Length:74 Identity:17/74 - (22%)
Similarity:27/74 - (36%) Gaps:26/74 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FIEDE----------KSPQEFFLDDNEAVENAFKG-------------VLPCTNSQKVSRSRRAS 176
            ||:.|          |:|.:.:|   ||:.|...|             .|..|:.:.|.::..|.
Mouse    48 FIDKEDLHDMLASLGKNPTDEYL---EAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIKNAFAC 109

  Fly   177 KSEEENDFV 185
            ..||...|:
Mouse   110 FDEEGTGFI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 5/20 (25%)
Nhlh2NP_848892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 10/35 (29%)
bHLH_TS_HEN2 63..135 CDD:381545 14/59 (24%)

Return to query results.
Submit another query.