DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Ascl2

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:285 Identity:63/285 - (22%)
Similarity:90/285 - (31%) Gaps:119/285 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 W--LPSSSNGADNADERSTASS------GSSGHSQTNESPR-----------SGHLNGNGSMRDT 48
            |  :|.....:|.....|.:|:      |::.|...:..||           :|....|.|:.|.
Mouse     7 WYGVPGLQEASDACPRESCSSALPEAREGANVHFPPHPVPREHFSCAAPELVAGAQGLNASLMDG 71

  Fly    49 AAGRHPPALLRHATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSL 113
            .           |.|.|.|.:..::.                                |.|.|..
Mouse    72 G-----------ALPRLMPTSSGVAG--------------------------------ACAARRR 93

  Fly   114 SSSPR----SHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRE 174
            .:||.    |..|....|..:||.::|                            .|:   |.||
Mouse    94 QASPELLRCSRRRRSGATEASSSSAAV----------------------------ARR---NERE 127

  Fly   175 RWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEP 239
            |.|.:.|:..|..||:.||....:|||||.|.||||::||:.|..:|      |....:||    
Mouse   128 RNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYIRALQRLL------AEHDAVRA---- 182

  Fly   240 NNNDNRMANGHAADGENLENPDVPP 264
                 .:|.|       |..|..||
Mouse   183 -----ALAGG-------LLTPATPP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 7/52 (13%)
HLH 134..176 CDD:197674 20/47 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.