DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Ascl1

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:84 Identity:35/84 - (41%)
Similarity:49/84 - (58%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRA 235
            |.|||.|.:.|:..||.||:.||....:||:||.|.||||::||:.|..:|:  :..|.|...:|
Mouse   119 NERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLD--EHDAVSAAFQA 181

  Fly   236 -----QMEPN-NND-NRMA 247
                 .:.|| :|| |.||
Mouse   182 GVLSPTISPNYSNDLNSMA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 25/53 (47%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92
bHLH_TS_ASCL1_Mash1 110..180 CDD:381585 27/62 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.