DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Lyl1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:244 Identity:83/244 - (34%)
Similarity:98/244 - (40%) Gaps:80/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TAAGRHPPALLRHATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRS 112
            ||.||.||.|..|..||  |...|:..|..    ..||:                     ..|..
Mouse    90 TALGRAPPTLAVHYHPH--PFLNSVYIGPA----GPFSI---------------------FPNSR 127

  Fly   113 LSSSPRSHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWR 177
            |...| |||...|  |.......|                            .|:||||:|||||
Mouse   128 LKRRP-SHSELDL--ADGHQPQKV----------------------------ARRVFTNSRERWR 161

  Fly   178 QQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQR------QAPSH---PI 233
            ||:|:|||||||||:||||||:||||||:||.|:|||..|..:|..|..      .||..   |.
Mouse   162 QQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQTAVLTSGPSAPGSRKPPA 226

  Fly   234 RAQMEPNNNDNRMANGHAADGENLENPDVP---------PVRHIKCERT 273
            |..:|   ...|...||..:... ..|.:|         .||.||.|:|
Mouse   227 RRGVE---GSARFGAGHRVEAAR-SQPVLPGDCDGDPNGSVRPIKLEQT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 37/50 (74%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
bHLH_TS_LYL1 145..209 CDD:381548 43/91 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7447
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43728
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5855
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.