DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and HLH4C

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_061498807.1 Gene:HLH4C / 1275714 VectorBaseID:AGAMI1_002064 Length:142 Species:Anopheles gambiae


Alignment Length:51 Identity:31/51 - (60%)
Similarity:38/51 - (74%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 TRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            ||||.|.:..:.||:|||||:||.||||||||.|||:.||.||..|..:|:
Mosquito    91 TRERIRVEAFNVAFSELRKLLPTLPPDKKLSKIEILKLAICYISYLNHVLD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 31/51 (61%)
HLH4CXP_061498807.1 None

Return to query results.
Submit another query.