DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and tcf23

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_001342593.4 Gene:tcf23 / 100002924 ZFINID:ZDB-GENE-090806-5 Length:277 Species:Danio rerio


Alignment Length:280 Identity:65/280 - (23%)
Similarity:92/280 - (32%) Gaps:98/280 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WL--PSSSNGADNADERSTASSGSSGHSQTNESPR-----SGHLNGNGSMRDTAAGRHP----PA 56
            |:  |..:.|.:.|..........|.|     .||     ..||....|:    ...||    |.
Zfish    12 WVTAPQQAQGVEAASAVGLQLQDGSLH-----FPRPFWGLHAHLPSLCSL----GSEHPWEAEPE 67

  Fly    57 LLRHATPHLQPKTESISDGDGDAEL-----------------------SDFSLNDTEEDEEDLR- 97
            :.:....|..|..|  ::| ||.|.                       .|.:....|:..:.|| 
Zfish    68 ITQRLKIHTLPHRE--AEG-GDEETHGLFCHLERRVQPAVPMAERALDEDMAWQRGEDGGKSLRT 129

  Fly    98 ----DYIVLNGNQADANRSLSSSPRSHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSG 158
                ...|....|.:|.:.:.|.|.:.||       |....:           |..||:      
Zfish   130 QTWNQTCVKLATQREAKKWVKSGPTASSR-------ACKSQT-----------SPENAA------ 170

  Fly   159 VGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLT----- 218
                          |||.|.:|:..||..|:..:|:.|||.||||.::|..|..||..||     
Zfish   171 --------------RERSRVRNLRQAFHSLQAALPSVPPDTKLSKLDVLVLATNYIAHLTETLDQ 221

  Fly   219 -GILEWQ---QRQAPSHPIR 234
             |:|..|   ||....||::
Zfish   222 GGMLGDQSVLQRVEYLHPVK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 23/56 (41%)
tcf23XP_001342593.4 HLH 170..221 CDD:197674 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.