DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and si:ch211-246m6.4

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_001340709.1 Gene:si:ch211-246m6.4 / 100000527 ZFINID:ZDB-GENE-050208-498 Length:193 Species:Danio rerio


Alignment Length:243 Identity:61/243 - (25%)
Similarity:82/243 - (33%) Gaps:72/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLRHATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPRSHS 121
            ||||..|.........|.|                      ::.:.:.:.|...:||.|.|..  
Zfish     5 LLRHGLPTTTLHAMKSSTG----------------------EHGLAHAHPAHDTQSLPSDPDD-- 45

  Fly   122 RNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRK--VFTNTRERWRQQNVSGA 184
                    ..|||.......|.|:.:.|:.......|.....||.|  ...|.|||.|..:|:.|
Zfish    46 --------LDSGSDSSEKSTGAGSPTRGHREVRRRRGSRRLAGVSKQRQAANARERDRTHSVNTA 102

  Fly   185 FAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEPNNNDNRMANG 249
            |..||.|:||.|.|:||||.|.||.|..||..|..:|                        :...
Zfish   103 FTSLRTLIPTEPADRKLSKIETLRLASSYISHLANVL------------------------LLGE 143

  Fly   250 HAADGE-------------NLENPDVPPVRHIKCERTDGQMHRNGIGH 284
            ...||:             ||::|.|.|:... |.....:|.|:|..|
Zfish   144 DCRDGQPCLKYHNILQSNANLKSPPVRPICTF-CLSNQRKMLRDGEKH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 26/50 (52%)
si:ch211-246m6.4XP_001340709.1 HLH 84..135 CDD:278439 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.