DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and AT3G61160

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_974471.1 Gene:AT3G61160 / 825288 AraportID:AT3G61160 Length:438 Species:Arabidopsis thaliana


Alignment Length:378 Identity:210/378 - (55%)
Similarity:279/378 - (73%) Gaps:10/378 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 IPKEVDR-----SKEKLEGAWETTGRDGSKITTVVATPGQGTDRVQEVSYTDTKVIGNGSFGVVF 662
            :|||:..     .|:...|..:..|.:..:|.| ....|....:.:.:||....|||.|||||||
plant    61 LPKEIREVGLGDDKDMDCGIIKGNGTESGRIIT-TKKKGLNDQKDKTISYRAEHVIGTGSFGVVF 124

  Fly   663 QAKLCDTGELVAIKKVLQDRRFKNRELQIMRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIP 727
            |||..:|.|.|||||||||:|:|||||||||.|:|.|:|:|.:.|:|:.|| ||::|||||||:|
plant   125 QAKCLETEEKVAIKKVLQDKRYKNRELQIMRMLDHPNVVELKHSFFSTTEK-DELYLNLVLEYVP 188

  Fly   728 ETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHS-LGICHRDIKPQNLLLDPETAVLKLCD 791
            ||:|:.:|.|.|..|.:|:.:|:||.||:.|::.|:|. :|:|||||||||||::..|..:|:||
plant   189 ETIYRASRSYTKMNQHMPLIYIQLYTYQICRAMNYLHQVVGVCHRDIKPQNLLVNNVTHEVKICD 253

  Fly   792 FGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQ 856
            |||||.|:.||||:|||||||||||||||||..||:.||:||.|||:|||.||.|:|||::.|||
plant   254 FGSAKMLIPGEPNISYICSRYYRAPELIFGATEYTSAIDMWSVGCVMAELFLGHPLFPGETSVDQ 318

  Fly   857 LVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 921
            |||:||:||||.||:|:.|||.|.:|||||||:.||.|:||.:...||::|.|.||:|:|:.|.|
plant   319 LVEIIKILGTPAREEIKNMNPRYNDFKFPQIKAQPWHKIFRRQVSPEAMDLASRLLQYSPNLRCT 383

  Fly   922 PLKACAHPFFDELRMEGNHTLPNGRDMPPLFNFTEHELS-IQPSLVPQLLPKH 973
            .|:||||||||:|| :...:|||||.:||||:||..||: ....|..:|:|:|
plant   384 ALEACAHPFFDDLR-DPRASLPNGRALPPLFDFTAQELAGASVELRHRLIPEH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 182/291 (63%)
S_TKc 647..931 CDD:214567 178/284 (63%)
AT3G61160NP_974471.1 STKc_GSK3 105..396 CDD:271039 182/291 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 418 1.000 Domainoid score I124
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 462 1.000 Inparanoid score I363
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 1 1.000 - - FOG0000635
OrthoInspector 1 1.000 - - mtm986
orthoMCL 1 0.900 - - OOG6_100482
Panther 1 1.100 - - O PTHR24057
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X378
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.