DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and Stkld1

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_006498172.1 Gene:Stkld1 / 279029 MGIID:2685557 Length:721 Species:Mus musculus


Alignment Length:340 Identity:75/340 - (22%)
Similarity:130/340 - (38%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 YTDTKVIGNGSFGVVFQAKLCDTGELVAIKKV-LQDRRFKNR---ELQIMRKLEHCNIVKLLYFF 707
            |...:::..|:.||....:..:|.....||:| ..|....|:   ||..:.||:|.|:......|
Mouse     4 YQLLQMLNPGALGVNLVVEELETETKFLIKQVECIDEHHANKALEELMPLLKLQHPNLSLYHEMF 68

  Fly   708 YSSGEKRDEVFLNLVLEYIPE-TVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHR 771
            .....:...:||.||::|..: |...:.....|.|..:...::...:.|:..::.|:|.|.|.||
Mouse    69 IMWNNEISSLFLCLVMDYYSQGTFQNIMENKRKLKAVVDTEWMHTMLSQVLDAIEYLHKLNIVHR 133

  Fly   772 DIKPQNLLLDPETAVLKLCDFGSAKQLLH---------------------GEPNVSYICSRYYRA 815
            ::||.|::| ..:...||.|..|...:.|                     |:|     |.:.:.|
Mouse   134 NLKPSNIVL-VNSGYCKLQDMSSQALMTHEAKWNVRAEEGVWGRLGMSGKGDP-----CQKSWMA 192

  Fly   816 PELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIK--------VLGTPTREQI 872
            ||.:  ..:::||.|:||.||::.::....  |..|:...||.:.|:        :|.|...:||
Mouse   193 PEAL--KFSFSTKSDIWSLGCIILDMATCS--FLNDTEAMQLRKAIRHHPGSLKPILKTMEEKQI 253

  Fly   873 REMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRME 937
                              |...|:.:        |:..:|...||.|:.........|.......
Mouse   254 ------------------PGTDVYYL--------LLPFMLHINPSDRLAIKDVMQVTFMSNSFKS 292

  Fly   938 GNHTLPNGRDMPPLF 952
            .:..|...|...|:|
Mouse   293 SSVALNMQRQKVPIF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 71/320 (22%)
S_TKc 647..931 CDD:214567 70/317 (22%)
Stkld1XP_006498172.1 S_TKc 4..286 CDD:214567 70/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.