DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and gsk31

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_595564.1 Gene:gsk31 / 2541233 PomBaseID:SPBC8D2.01 Length:381 Species:Schizosaccharomyces pombe


Alignment Length:363 Identity:193/363 - (53%)
Similarity:252/363 - (69%) Gaps:19/363 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 DGSKITTVVATPGQGTDRVQEVSYTDTKVIGNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKNRE 688
            |.|.:.|.|.|.|. |...:.:||...:|:|:||||||.||||..|...:|:|:||||:|:||||
pombe     3 DDSHLETKVVTDGT-TGEKKTISYEPCRVLGSGSFGVVIQAKLVGTPGFIAVKRVLQDKRYKNRE 66

  Fly   689 LQIMRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYM 753
            |||||.:.|.||:||:.||::....:||..|.|:|||:||||:...|.|.:.:::||...|:||.
pombe    67 LQIMRAISHPNIIKLIAFFHTHNPSKDETHLCLLLEYMPETVFDDMRWYTRRRKSIPNLSIKLYA 131

  Fly   754 YQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPEL 818
            :||||:|||:||.|:|||||||||||:|.:|.:||||||||||.|:..|||||||||||||||||
pombe   132 FQLFRALAYLHSTGVCHRDIKPQNLLVDYKTGILKLCDFGSAKVLVPSEPNVSYICSRYYRAPEL 196

  Fly   819 IFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFK 883
            :|||.:||||||||||.||:|||.:|:|:|||||.|:||||:|:|||||:..:|..|||||....
pombe   197 VFGATHYTTKIDVWSAACVIAELFIGRPLFPGDSSVEQLVEIIRVLGTPSYHEISVMNPNYVNHS 261

  Fly   884 FPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPN---- 944
            .|.::.|..:.|........|::|:..:|.|.||.||:.::...||||||||.      ||    
pombe   262 LPNVRPHTLESVMPHNCTKNAMDLLHKMLTYVPSKRISAIEVLTHPFFDELRD------PNCMYH 320

  Fly   945 --------GRDMPPLFNFTEHELSIQPSLVPQLLPKHL 974
                    .|.:||||||...||||:|:|...:||.|:
pombe   321 CSRDEGTIERHLPPLFNFNLAELSIRPNLNKAILPPHV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 165/290 (57%)
S_TKc 647..931 CDD:214567 161/283 (57%)
gsk31NP_595564.1 STKc_GSK3 20..312 CDD:271039 165/291 (57%)
S_TKc 25..309 CDD:214567 161/283 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 435 1.000 Inparanoid score I319
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000635
OrthoInspector 1 1.000 - - mtm9293
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X378
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.