DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and Y106G6E.1

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_492689.1 Gene:Y106G6E.1 / 190919 WormBaseID:WBGene00013705 Length:381 Species:Caenorhabditis elegans


Alignment Length:340 Identity:111/340 - (32%)
Similarity:165/340 - (48%) Gaps:50/340 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 TDRVQEVSYTDTK----------VIGNGSFGVVFQ--AKLCDTGEL-VAIKKVLQDRRFKNRELQ 690
            ||.:......|.|          :...|:|..|::  |:.....|: :.|||.....:....|::
 Worm     8 TDEIVAQRLEDGKDMHLNLHHMNLFATGAFSNVYRGVAQTESNQEIDIVIKKTWPRHKGCPMEVK 72

  Fly   691 I---MRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTK-QTIPINFIRL 751
            |   :.||:|.|||:|||.:....|.|  :.|.|:.||||..:|    |:.|.| :.|.|..::|
 Worm    73 ILGQLGKLKHRNIVRLLYSYQKQHEGR--ICLALIFEYIPLNLY----QFLKDKNRRIDIVEVKL 131

  Fly   752 YMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAP 816
            .::||||..|::....||||||||||||.:.||.:||:.||||:.......|..||..:||||.|
 Worm   132 IVWQLFRGQAHLEKADICHRDIKPQNLLYNAETGLLKISDFGSSSIQSTKSPQQSYHVTRYYRPP 196

  Fly   817 ELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTE 881
            |||.|:..|..|||.||.|||..|||.|..|..|.|..:|...:..:||.||...:..|..:.|:
 Worm   197 ELILGSKYYGCKIDTWSCGCVFGELLKGGIILAGKSSNNQAEVIFDMLGYPTDSDVSSMKVSSTK 261

  Fly   882 FK-----FPQIKSHPWQKVFRIRTPT----------------------EAINLVSLLLEYTPSAR 919
            .:     :...||.....:..:.|.|                      |::.::..:|.|.|:.|
 Worm   262 LQEVLDSYEYNKSKTTADLTYLYTQTVIYQKDRRTTVYNTKIEQDDMKESVAVLLQILVYNPNKR 326

  Fly   920 ITPLKACAHPFFDEL 934
            ::.::...||:|:.|
 Worm   327 LSGIEILTHPYFNVL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 108/334 (32%)
S_TKc 647..931 CDD:214567 107/327 (33%)
Y106G6E.1NP_492689.1 STKc_GSK3 29..341 CDD:271039 106/317 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.