DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and C44H4.6

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_510429.1 Gene:C44H4.6 / 183461 WormBaseID:WBGene00008095 Length:367 Species:Caenorhabditis elegans


Alignment Length:345 Identity:149/345 - (43%)
Similarity:217/345 - (62%) Gaps:7/345 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 TVVATPGQGT--DRVQEVSYTDTKVIGNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKNRELQIM 692
            ||:|..|.|:  ||..|:.:|:.::||.||||.|::|.|.:..|.:||||:..|.|||:|||.||
 Worm    18 TVMAKRGTGSKLDREVEIQFTNLQLIGTGSFGAVYKAVLRENDEPIAIKKIKVDDRFKSRELTIM 82

  Fly   693 RKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLF 757
            .:::|.||::|||::.    .:.|..||.|:|::|:.:..|.||:|...:.:|...|:|||:||.
 Worm    83 HEMDHPNIIRLLYYYV----MQQENCLNFVMEFMPKDLAYVHRQFAHNDKQMPAYSIKLYMFQLL 143

  Fly   758 RSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGA 822
            |.:.::|...|.||||||:|||:|....:||:|||||||:|...|||::|||||||||||||||:
 Worm   144 RGIGFLHLHNIVHRDIKPKNLLVDESNGILKICDFGSAKRLEKNEPNITYICSRYYRAPELIFGS 208

  Fly   823 INYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQI 887
            .||.|.||.||.|.|:.|||...|||..||.||.|...||..|||::|.:.:.|..|....:..|
 Worm   209 KNYDTSIDTWSVGTVVGELLHNSPIFLADSAVDILALQIKAFGTPSKEDMAKWNYEYVHIPYDTI 273

  Fly   888 KSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLF 952
            .....||....:.....:.|::.|::..|..||.|.:|...|:||:|| :.::.||:|..:||||
 Worm   274 TGVGIQKFIGRKLSLSTLELLNSLMKMDPKLRIKPYEALTLPYFDDLR-DPHYKLPSGAPIPPLF 337

  Fly   953 NFTEHELSIQPSLVPQLLPK 972
            ::.|.|......::..:.|:
 Worm   338 DWLEREYIANHEIIKDIFPR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 130/290 (45%)
S_TKc 647..931 CDD:214567 127/283 (45%)
C44H4.6NP_510429.1 STKc_GSK3 32..320 CDD:271039 130/291 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.