DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and gsk-3

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_001379044.1 Gene:gsk-3 / 173149 WormBaseID:WBGene00001746 Length:362 Species:Caenorhabditis elegans


Alignment Length:330 Identity:242/330 - (73%)
Similarity:280/330 - (84%) Gaps:2/330 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 RDGSKITTVVATPG-QGTDRVQEVSYTDTKVIGNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKN 686
            :.|.::|.|||:.. .|.|:..|:||.|.||||||||||||.|||..|.|:|||||||||:||||
 Worm    11 KSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKN 75

  Fly   687 RELQIMRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRL 751
            |||||||||.|.|||||.|||||||||:||::|||:|||:|||||:|||.|:|.:|.||:.:::|
 Worm    76 RELQIMRKLNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKL 140

  Fly   752 YMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAP 816
            |||||.||||||||:|||||||||||||:|||:.|||||||||||.|:..|||||||||||||||
 Worm   141 YMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAP 205

  Fly   817 ELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTE 881
            ||||||.|||..|||||||.|:|||||||||||||||||||||:||||||||||||:.|||||.|
 Worm   206 ELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKE 270

  Fly   882 FKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGR 946
            |||||||:|||.||||:.||.|||:|:|.::||||::|.||..||.|.|||||| ..:..||:||
 Worm   271 FKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELR-NPDARLPSGR 334

  Fly   947 DMPPL 951
            .:|.|
 Worm   335 PLPTL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 226/290 (78%)
S_TKc 647..931 CDD:214567 221/283 (78%)
gsk-3NP_001379044.1 STKc_GSK3 31..323 CDD:271039 226/291 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159246
Domainoid 1 1.000 468 1.000 Domainoid score I218
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 500 1.000 Inparanoid score I751
Isobase 1 0.950 - 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 1 1.000 - - FOG0000635
OrthoInspector 1 1.000 - - otm14465
orthoMCL 1 0.900 - - OOG6_100482
Panther 1 1.100 - - LDO PTHR24057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R530
SonicParanoid 1 1.000 - - X378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.