DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgg and gska-3

DIOPT Version :9

Sequence 1:NP_001259193.1 Gene:sgg / 31248 FlyBaseID:FBgn0003371 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_492367.1 Gene:gska-3 / 172683 WormBaseID:WBGene00007977 Length:381 Species:Caenorhabditis elegans


Alignment Length:335 Identity:107/335 - (31%)
Similarity:163/335 - (48%) Gaps:54/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 RVQEVSYTDTKVIGNGSFGVVFQ--AKLCDTGEL-VAIKKVLQDRRFKNRELQI-----MRKLEH 697
            |...:|..:..:..:|:|..|::  |:.....:: :.|||...  |.|...|::     :.||:|
 Worm    20 RDMNLSLQNMNLFASGAFSNVYRGIARTESNHQMEIVIKKTWP--RHKGCPLEVKILGKLGKLKH 82

  Fly   698 CNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAK-TKQTIPINFIRLYMYQLFRSLA 761
            .|||:||:.:....|.|  :.|.|:.||||..::    |:.| ..:.:.|..::|.::||||..|
 Worm    83 KNIVRLLFSYQKQHEGR--ICLGLIFEYIPMNLH----QFLKDNNRRVDIIEVKLIVWQLFRGQA 141

  Fly   762 YIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYT 826
            ::....||||||||||||.:.:|.:||:.|:||:.......|..||..:||||.|||:.|:.||.
 Worm   142 HLEKSEICHRDIKPQNLLYNADTGLLKISDYGSSAIESVKTPQQSYHVTRYYRPPELLLGSKNYG 206

  Fly   827 TKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFK-------- 883
            .|||.||.|||..|||.|.....|.|..:|...|..:.|.||.|.:..||.:.|::|        
 Worm   207 CKIDTWSCGCVFGELLKGGIFLAGKSAKNQAEVVFDMFGVPTAEDVSSMNVSNTKYKEIIQSYEP 271

  Fly   884 ------------FPQIKSHPWQKVFRIRTPT------------EAINLVSLLLEYTPSARITPLK 924
                        :.|..|..     |.|..|            :::.|:..:|.|.||.|:..::
 Worm   272 DTSKRTADLAYLYNQTASFQ-----RDRRSTVYNTKIDYSDMKDSVELLRQVLVYNPSRRLCGIE 331

  Fly   925 ACAHPFFDEL 934
            ...:|||..|
 Worm   332 FLTNPFFTVL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sggNP_001259193.1 STKc_GSK3 643..934 CDD:271039 105/331 (32%)
S_TKc 647..931 CDD:214567 102/324 (31%)
gska-3NP_492367.1 PKc_like 23..338 CDD:389743 103/327 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.