DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi4KIIIalpha and PI-4KBETA1

DIOPT Version :9

Sequence 1:NP_001259191.1 Gene:Pi4KIIIalpha / 31247 FlyBaseID:FBgn0267350 Length:2154 Species:Drosophila melanogaster
Sequence 2:NP_201212.1 Gene:PI-4KBETA1 / 836528 AraportID:AT5G64070 Length:1121 Species:Arabidopsis thaliana


Alignment Length:264 Identity:113/264 - (42%)
Similarity:170/264 - (64%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1896 W--QAAIFKVGDDVRQDMLALQVITIFKNIFQQVGLDLFLFPYRVVATAPGCGVIECVPNAKSRD 1958
            |  ::.|.|.|||.||:.||:|:|:.|.:|||:.||.|:|.||.|:.|:....:||.:|:..|..
plant   856 WDLRSIIVKSGDDCRQEHLAVQLISHFYDIFQEAGLPLWLRPYEVLVTSSYTALIETIPDTASIH 920

  Fly  1959 QLGRQ--TDSGLSEYFQHQYGDESSKEFQAARANFVKSMAAYSLIGYLLQIKDRHNGNIMIDKDG 2021
            .:..:  ..:.|.::|..:| .|:|..|:.|:.|||:|||.|||:.||||:|||||||:::|::|
plant   921 SIKSRYPNITSLRDFFVAKY-KENSPSFKLAQRNFVESMAGYSLVCYLLQVKDRHNGNLLLDEEG 984

  Fly  2022 HIIHIDFGFMFESSPGGNIGFE-PDMKLTDEMVMIMGGKMD---SPAFKWFCELCVQAFLAVRPY 2082
            ||||||||||..:|||| :.|| ...|||.|::.:|....|   |..|.:|..||:|.||..|.:
plant   985 HIIHIDFGFMLSNSPGG-VNFESAPFKLTRELLEVMDSDADGVPSEFFDYFKVLCIQGFLTCRKH 1048

  Fly  2083 QDAIVSLVSLMLDTGLPCFRG--QTINLLKQRFVATKNNKEAAAHMLAVIRNSYQNFRTRTYDMI 2145
            .:.|:.||.::.|:|.|||:|  :||..|::||..:...::..:.:|::|.:|...:|||.||  
plant  1049 AERIILLVEMLQDSGFPCFKGGPRTIQNLRKRFHLSLTEEQCVSLVLSLISSSLDAWRTRQYD-- 1111

  Fly  2146 QYYQ 2149
             |||
plant  1112 -YYQ 1114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi4KIIIalphaNP_001259191.1 PI4Ka 1600..1775 CDD:238443
PI4Kc_III_alpha 1836..2153 CDD:270711 113/264 (43%)
PI-4KBETA1NP_201212.1 TFIIF_alpha <230..540 CDD:253391
PI4Kc_III_beta 831..1121 CDD:270712 113/264 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1147978at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.