Sequence 1: | NP_001259191.1 | Gene: | Pi4KIIIalpha / 31247 | FlyBaseID: | FBgn0267350 | Length: | 2154 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016864840.1 | Gene: | SH3PXD2B / 285590 | HGNCID: | 29242 | Length: | 939 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 39/206 - (18%) |
---|---|---|---|
Similarity: | 71/206 - (34%) | Gaps: | 62/206 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 1754 QQHKDPNL-YEALDQLSQSIIASFSGAAKRFYEREFDFFGKITAVSGEIRSFAKGIERKNACLAA 1817
Fly 1818 LSRIKVQGG---------CYLPSN---PEAMVLDIDYSSGTPMQSAAKA-----PYLARFRVYRC 1865
Fly 1866 G--ITELETRAMEVSNNPNSQEDAKMTLGVESWQAAIFKVGDDVRQDMLALQVITIFKNIFQQVG 1928
Fly 1929 LDLFLFPYRVV 1939 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pi4KIIIalpha | NP_001259191.1 | PI4Ka | 1600..1775 | CDD:238443 | 5/21 (24%) |
PI4Kc_III_alpha | 1836..2153 | CDD:270711 | 23/111 (21%) | ||
SH3PXD2B | XP_016864840.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |