DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi4KIIIalpha and CG30184

DIOPT Version :9

Sequence 1:NP_001259191.1 Gene:Pi4KIIIalpha / 31247 FlyBaseID:FBgn0267350 Length:2154 Species:Drosophila melanogaster
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:104 Identity:27/104 - (25%)
Similarity:38/104 - (36%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1810 RKNACLAALSRIKVQGGCYLPSNPEAMVLDIDYS------------SGTPMQ----SAAKAPYLA 1858
            |.||.:|..:     |..||.....|:.|...:|            |..|:|    |.....||:
  Fly   112 RDNAIVALYA-----GAIYLMHCTFALDLMFSHSRSRANQKMHPQRSKRPLQLYFISRGAEAYLS 171

  Fly  1859 RFRVYR---------CGITELETRAMEVSNNPNSQEDAK 1888
            ||..:|         ...:|...|..:||:: .|..|||
  Fly   172 RFWFFRRIAARMLTSAQPSEHSGRKRQVSSS-ESDSDAK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi4KIIIalphaNP_001259191.1 PI4Ka 1600..1775 CDD:238443
PI4Kc_III_alpha 1836..2153 CDD:270711 19/78 (24%)
CG30184NP_726341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.