DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv3 and CG42685

DIOPT Version :9

Sequence 1:NP_001284831.1 Gene:brv3 / 31246 FlyBaseID:FBgn0040333 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_609717.5 Gene:CG42685 / 34854 FlyBaseID:FBgn0261571 Length:1609 Species:Drosophila melanogaster


Alignment Length:555 Identity:92/555 - (16%)
Similarity:178/555 - (32%) Gaps:217/555 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HYSDKYWRIYEP------------WIPIKM-----GFEFLDALL--MNFDHV--GSLNSYPELAG 296
            ::.:.||...:|            :.|::.     .|:..:.|:  .|..|.  .|.|.|     
  Fly  1041 NFHNIYWWYPDPFPSKTSVLIVHAYSPVQFFRSAKEFQLTNPLVYKTNITHFNDASFNQY----- 1100

  Fly   297 YVSLLARSAANSMKVIDY-LSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGG---- 356
               :...|..||.:|..| :..||...|....|.....:|         ..:|:.:.|..|    
  Fly  1101 ---MTNNSIQNSTEVHIYSVMLNHKAMLAVRIVNCSELMY---------IKMRLHRWPTLGQIRQ 1153

  Fly   357 ----IVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKLWYEPHLLKSVWNKLDL 417
                |.||:|.....:..:.::.|        .||.:             ::|..::  :...| 
  Fly  1154 HACRITPDMQGKRIWIANSCERSP--------AYVAI-------------HKPGEIR--YKTED- 1194

  Fly   418 FIFMVNVLVVVLVVLRESLVASMMKK----------VEGASKMEFIDFRRPSRMHQLTTITIGFL 472
                           ::.|.|...||          .|...|.:|||:.....:.::..:....|
  Fly  1195 ---------------KDQLSARGRKKGNRTHDGSETPEVRQKADFIDYDNEDIVEEVLPLNYSIL 1244

  Fly   473 ICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKLV 537
            :.|....:|:           .|:|...||                       ..:.:::|....
  Fly  1245 LEIYQCNIWK-----------NRSLDPGWS-----------------------EDHCTTSFEHSR 1275

  Fly   538 KSMVMCMCYSFG-FSAQVKP--SELFHGGKWLGILCYGV-------LAFVIIVLLINVFVSLIND 592
            .|.|.|.|::.| .|:::.|  |:||.....:.|..:.:       |.|:::|....:.:::|:.
  Fly  1276 GSSVQCTCHTLGALSSRIFPISSQLFVEHIPVPIFTFNMILMIFFALLFLLLVFKFLLHLNIISA 1340

  Fly   593 YF-----------TVAKTIRDSERENRITFFEFLVV------EFSGVLGRFRKLPCWRRNYVRNG 640
            |.           :|.|:     .::.::..|.|:|      ||:|                   
  Fly  1341 YLKNPEFRLQCDASVGKS-----DQSFVSGSEILLVIVTGGQEFAG------------------- 1381

  Fly   641 RTVAENVSRKLDSMDRQ-------------RLMRR---RLRQGRHHVSRPVSAEDALLEYKDRGD 689
              ...||...|.|..||             :|:|.   ::...|.|:..|......|:.      
  Fly  1382 --TTSNVKFYLKSPHRQQTSYQITQDPGHPKLLRNSTIKIMVPRGHIYIPTRLALRLVP------ 1438

  Fly   690 KMVNVHY---------ILNIQLTLIRMFLFDEYVE 715
               |..|         :::::|.:.::||.:.::|
  Fly  1439 ---NGRYPSWYCRSITVVDLKLKVQQLFLVESWIE 1470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv3NP_001284831.1 PKD_channel 170..595 CDD:285288 66/402 (16%)
CG42685NP_609717.5 REJ 411..753 CDD:307914
PLAT 1367..1480 CDD:238061 24/134 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.