DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv3 and Loxhd1

DIOPT Version :9

Sequence 1:NP_001284831.1 Gene:brv3 / 31246 FlyBaseID:FBgn0040333 Length:750 Species:Drosophila melanogaster
Sequence 2:XP_038952562.1 Gene:Loxhd1 / 291427 RGDID:1304815 Length:2278 Species:Rattus norvegicus


Alignment Length:129 Identity:22/129 - (17%)
Similarity:50/129 - (38%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DLFMYN-HTDYTGLQEVYFLNQLFDFIEST------------LVLAFNSN--------STESGSP 203
            :|..|| ..|...|:..|:..::::.:.:|            .:..|..|        :::|.| 
  Rat    22 ELLNYNSEDDEDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITIFGENGLSPKLHLTSKSES- 85

  Fly   204 GWAHAEQSVLLGVMRLR--------QLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYW 259
                |.:...:.|.|:|        ::|:.:...||....:.|...:.|.:.|:.:.:::...|
  Rat    86 ----AFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNW 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv3NP_001284831.1 PKD_channel 170..595 CDD:285288 18/118 (15%)
Loxhd1XP_038952562.1 PLAT_repeat 43..162 CDD:238854 16/108 (15%)
PLAT_repeat 172..289 CDD:238854
PLAT_repeat 296..414 CDD:238854
PLAT_repeat 425..542 CDD:238854
PLAT_repeat 554..675 CDD:238854
PLAT_repeat 684..805 CDD:238854
PLAT 816..>896 CDD:412108
PLAT_repeat 1026..1146 CDD:238854
PLAT_repeat 1180..1300 CDD:238854
PLAT_repeat 1311..1437 CDD:238854
PLAT_repeat 1465..1585 CDD:238854
PLAT 1634..1749 CDD:396180
PLAT_repeat 1763..1880 CDD:238854
PLAT_repeat 1890..2010 CDD:238854
PLAT 2023..2124 CDD:412108
PLAT_repeat 2159..2277 CDD:238854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.