DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv3 and PRY

DIOPT Version :9

Sequence 1:NP_001284831.1 Gene:brv3 / 31246 FlyBaseID:FBgn0040333 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_001104126.3 Gene:PRY / 26067055 FlyBaseID:FBgn0267489 Length:1247 Species:Drosophila melanogaster


Alignment Length:377 Identity:74/377 - (19%)
Similarity:125/377 - (33%) Gaps:138/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EDVKFKTMLVSIVIVLIF-QFLIGDPIKFVILSIDRALWPPRIYIPPRCDKDEMDEKE------- 90
            ||::.:......|:|:|. .|.:.|.:. |.:.:.|.               |||:.:       
  Fly   408 EDIQVRLPPTEHVVVMICDHFSVCDDVT-VTVEVRRL---------------EMDDSDNTVKEAL 456

  Fly    91 -------ERRDFLKQRLINKRANLMLTSRYRNYKLNDQYKMIAHDLFIYGPY-FLCLMCLVLVTR 147
                   |..|:.|..|:..:...::.|:.|.....|       .|::|.|. .:.|..||.:|:
  Fly   457 SLARHWFEYADWQKAFLLLYQVAKLIKSKERLLNFID-------TLYVYEPQTTVQLAHLVRLTK 514

  Fly   148 DQTL-------------YHNTRIITDLF--MYNHTDYTGLQEVYF---LNQLFDFIESTLVLAFN 194
            ...|             ....::|:..|  :.|..:...|.::|:   :|:|.|.:        |
  Fly   515 RVVLSLEPLDDMEVNVVARMLQLISSTFRLIINSNELNTLMDIYYETMVNELCDIL--------N 571

  Fly   195 SNSTESGSPGWAH-------AEQSVLLGV----MRLRQLRVSNPQVGLGPPKFSDTYYMPDWQL- 247
            ..:||     |.:       ||....|.:    .||.|:.|..|| ||   :..:.:....|:| 
  Fly   572 KLNTE-----WEYIPKSQCRAESESCLNIDNFRNRLEQMSVLRPQ-GL---EHINNWLHAHWKLS 627

  Fly   248 ---------PYRKLHYSDKYWRIYEPWIPIKM-GFE-------------------FLDALL---- 279
                     ..|:||..:....|......::| .|:                   |.|.||    
  Fly   628 SCLFYMGMGTARRLHPEEGPKLIERSTFSMRMESFDLDQDRNLEFQSADSMHTLIFTDKLLDELK 692

  Fly   280 --MNFDHV-GSLNS--------YPELAGYVSLLARSAANSMKVIDYLSENHW 320
              :..|.| .|:.|        |||...:..:|..:|        |...|.|
  Fly   693 RRLRTDEVLISIRSHKQSQYWWYPEQESHTQVLVVNA--------YTINNIW 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv3NP_001284831.1 PKD_channel 170..595 CDD:285288 44/210 (21%)
PRYNP_001104126.3 REJ <189..452 CDD:280229 12/59 (20%)
PLAT 1019..1111 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.