DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv3 and loxhd1b

DIOPT Version :9

Sequence 1:NP_001284831.1 Gene:brv3 / 31246 FlyBaseID:FBgn0040333 Length:750 Species:Drosophila melanogaster
Sequence 2:XP_001920640.3 Gene:loxhd1b / 100150283 ZFINID:ZDB-GENE-081104-370 Length:2268 Species:Danio rerio


Alignment Length:247 Identity:41/247 - (16%)
Similarity:86/247 - (34%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RCDKDEMDEKEERRDF-LKQRLINKRANL----------MLTSRYRNYKLNDQYKMIAHDLFIYG 133
            :.:|::.:.:|:..|. .|::..:|:.|.          ....:.:..|..|..::..::|..|.
Zfish    17 KAEKEDSEPEEDDEDSRKKKKKKSKKGNADSDDDGKKSKDKKKKKKKSKTEDYVEIYENELRNYE 81

  Fly   134 PYFLCLMCLVLVTRDQTLYHNTRIITDLFMYNHTDYTGLQEVYFLNQLFDF-------IESTLVL 191
            |        ..|...:..||..::...:.:....:..|.....|:....|:       :.|....
Zfish    82 P--------EKVENYEDEYHKKKVYEVVTITGDVNGAGTDANVFVTLFGDYGITPKLHLSSKNRT 138

  Fly   192 AFNSNSTESGSPGWAHAEQSVLLGVMR--------LRQLRVSNPQVGLGPPKFSDTYYMPDWQLP 248
            :|..|.|:                |.|        |:::|:.:...||....|.|...:.|...|
Zfish   139 SFEKNKTD----------------VFRVKTHNVGPLKKIRIEHDNTGLNASWFLDRVVVTDMNRP 187

  Fly   249 YRKLHYSDKYWRIYEPWIPIKMGFEFLDALLMNFDHVGSLN--SYPELAGYV 298
            :.:.:::...|          :..:..|.|.:. |.:|||:  ..|:...||
Zfish   188 HLRFYFACNNW----------LSRDEGDGLYVR-DLLGSLDPMDMPKYNKYV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv3NP_001284831.1 PKD_channel 170..595 CDD:285288 27/146 (18%)
loxhd1bXP_001920640.3 PLAT_repeat 96..215 CDD:238854 21/145 (14%)
PLAT_repeat 225..342 CDD:238854 2/4 (50%)
PLAT_repeat 349..467 CDD:238854
PLAT_repeat 478..595 CDD:238854
PLAT_repeat 606..727 CDD:238854
PLAT_repeat 737..858 CDD:238854
PLAT_repeat 867..1020 CDD:238854
PLAT_repeat 1028..1146 CDD:238854
PLAT_repeat 1173..1293 CDD:238854
PLAT_repeat 1304..1431 CDD:238854
PLAT_repeat 1458..1578 CDD:238854
PLAT 1624..1741 CDD:294016
PLAT_repeat 1753..1871 CDD:238854
PLAT_repeat 1881..2001 CDD:238854
PLAT 2014..2118 CDD:279778
PLAT_repeat 2149..2267 CDD:238854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.