DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Seipin and AT5G16460

DIOPT Version :9

Sequence 1:NP_570012.1 Gene:Seipin / 31245 FlyBaseID:FBgn0040336 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_197150.1 Gene:AT5G16460 / 831507 AraportID:AT5G16460 Length:368 Species:Arabidopsis thaliana


Alignment Length:228 Identity:51/228 - (22%)
Similarity:99/228 - (43%) Gaps:26/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IAFAVVLIIWLAVFMYAAF--YYVYMPAISHTRPVHMQFKTCLETSTPCTFPHAHVSLTKKQQ-- 118
            ::..:||.:.|||.:....  .||..|.:...|   :.|....|.      |.|..|..||::  
plant    98 VSMVMVLALILAVVIGVGIVSLYVEKPVVVRDR---LFFDYTEEN------PSAVFSFDKKKRSF 153

  Fly   119 LLMVGQAYKVIVNIDMPESPQNLELGMFMVCAEMRDYDSMLRGHSCRSAMMRYRSPLIRMISTWV 183
            .:.||.:..|.:.:.||||..|..:|:|.:..|:..........|.:..|:|:||..||:..|:|
plant   154 SVPVGHSVHVSLVLWMPESEINRRIGVFQLKVELLSLKGETIARSSQPCMLRFRSKPIRLARTFV 218

  Fly   184 LSPLYVLGWKEEFQQVPVEIFSRYLEERQHPIT-----DVYVEIQSQKI-QFYTVTLHIVADFTG 242
            :|...:.|...|.|.:.::...   .:.:.|.|     .:....|::.: |.|...:.|.:....
plant   219 MSVPLIAGIANEAQTMRIDALK---HQEKMPRTKAVRATLIPRAQTRTLPQLYEAEIVINSKPPW 280

  Fly   243 LRYIMFNWPVLSAIVAISTNLF-FILVVFLLSW 274
            ::.:.:||   ...:.:.|::: ::.::..|.|
plant   281 IKRMAYNW---KWTLCVWTSMYLYVAILTALLW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SeipinNP_570012.1 Seipin 63..262 CDD:284243 48/208 (23%)
AT5G16460NP_197150.1 Seipin 104..299 CDD:284243 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4581
eggNOG 1 0.900 - - E1_KOG4200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2641
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21212
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.