DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and TSPAN10

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001277141.2 Gene:TSPAN10 / 83882 HGNCID:29942 Length:355 Species:Homo sapiens


Alignment Length:266 Identity:99/266 - (37%)
Similarity:139/266 - (52%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDK---WEDANGSVRLENFYDVFLNISLVMILAGT 101
            |.||||:|||.||.|.|.|.|.|.||::....|   ..|..|.:..:..        |.:.|.|.
Human    73 SSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPM--------LGLALGGL 129

  Fly   102 VIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIA---IVCFVCPQYMNTFLEKQFTHKII 163
            |:..||.:|.:|||.|||.||:.:|..:|.|.:|| |:|   :|....|  :...||......|.
Human   130 VVSAVSLAGYLGALCENTCLLRGFSGGILAFLVLE-AVAGALVVALWGP--LQDSLEHTLRVAIA 191

  Fly   164 HSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSG 228
            | |:|||||:..:|..|...:|||.::  ||||.:|.|||||||.|:.|.:|.||||:..: ...
Human   192 H-YQDDPDLRFLLDQVQLGLRCCGAAS--YQDWQQNLYFNCSSPGVQACSLPASCCIDPRE-DGA 252

  Fly   229 LVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEG 293
            .||..||:||.......|.::::..||...:|.|...||....|.|:.:.|:|...:.||..|.|
Human   253 SVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIAVVLLQGAELLLAARLLG 317

  Fly   294 QIELQK 299
            .:..::
Human   318 ALAARR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 98/258 (38%)
penumbra_like_LEL 144..267 CDD:239411 46/122 (38%)
TSPAN10NP_001277141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
oculospanin_like_LEL 172..291 CDD:239420 47/124 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.