DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tspan15

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_932113.2 Gene:Tspan15 / 70423 MGIID:1917673 Length:294 Species:Mus musculus


Alignment Length:269 Identity:97/269 - (36%)
Similarity:147/269 - (54%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGYSGIEVHEVMHPHHFTYVSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLEN 84
            ||.|    .:|.:...|:|:  .:|:.:.:.:.||||.|||:|.:|:||..::       .:.:.
Mouse     3 RGDS----EQVRYCARFSYL--WLKFSLIIYSTVFWLIGGLVLSVGIYAEAER-------QKYKT 54

  Fly    85 FYDVFLNISLVMILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQY 149
            ....||..::::||.|.|:|:|||.|.:.:||:|..||:.:...|.:..::|:...||..:....
Mouse    55 LESAFLAPAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQ 119

  Fly   150 MNTFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGV 214
            ...||.... .:.|.:|.||.|.:|.:||.|::|||||  ...|:|||||:|.:||:|....|||
Mouse   120 TIDFLNDNI-RRGIENYYDDLDFKNIMDFVQKKFKCCG--GEDYRDWSKNQYHDCSAPGPLACGV 181

  Fly   215 PYSCCI-NATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIA 278
            ||:||| |.||:    ||.||||...:.....|..:|...||...|.:|...|..::||..|||.
Mouse   182 PYTCCIRNTTDV----VNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLGIL 242

  Fly   279 LIQLLVIYL 287
            |.|.|.:.|
Mouse   243 LPQFLGVLL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 91/247 (37%)
penumbra_like_LEL 144..267 CDD:239411 49/123 (40%)
Tspan15NP_932113.2 Tetraspannin 19..256 CDD:278750 91/247 (37%)
penumbra_like_LEL 114..231 CDD:239411 49/123 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.