DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tspan10

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_003751041.2 Gene:Tspan10 / 688308 RGDID:1590062 Length:326 Species:Rattus norvegicus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:138/263 - (52%) Gaps:11/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLVMILAGTVIF 104
            |.||||:|||.||:|.|...|.|..|::....|....:|...     .:..:..||::|.|.|:.
  Rat    72 SSCVKYLIFLSNFLFSLPALLALAAGLWGLAVKRSQGSGWGE-----PLPTDPMLVLMLGGLVVS 131

  Fly   105 LVSFSGCVGALRENTFLLKFYSMCLLLFFLLE-MAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRD 168
            :||.|||:||..||:.||..|...:|....|| :|.|:|..:.....::.  |:..|..|..|.:
  Rat   132 VVSLSGCLGAFCENSCLLHCYYGAVLSCLALEALAGALVVTLWDPLQDSL--KRTLHLAIIHYWN 194

  Fly   169 DPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGLVNIM 233
            ||||...:|..|...:|||..:  ||||.:|.|||||||.|:.|.:|.|||||..: ...:||..
  Rat   195 DPDLHFLLDQVQLGLQCCGAES--YQDWQQNLYFNCSSPGVQACSLPASCCINLQE-DGAVVNTQ 256

  Fly   234 CGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQIELQ 298
            ||.|..:.....|.::::..||..:::.|...|:..|.|.|:.:.:||...:.||..|...:.:.
  Rat   257 CGLGALHLDPNAAGQVVYLQGCWPVLQEWLRGNVGAIGGCAVAVIMIQGTELLLAACLLRALAVH 321

  Fly   299 KSR 301
            |::
  Rat   322 KAQ 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 90/253 (36%)
penumbra_like_LEL 144..267 CDD:239411 42/122 (34%)
Tspan10XP_003751041.2 Tetraspannin 74..304 CDD:278750 85/239 (36%)
oculospanin_like_LEL 171..289 CDD:239420 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.