DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tspan15

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001108504.1 Gene:Tspan15 / 679462 RGDID:1588304 Length:294 Species:Rattus norvegicus


Alignment Length:269 Identity:99/269 - (36%)
Similarity:148/269 - (55%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGYSGIEVHEVMHPHHFTYVSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLEN 84
            ||.|    .:|.:...|:|:|  :|:.:.:.:.||||.|||:|.:|:||..::       .:.:.
  Rat     3 RGDS----EQVRYCARFSYLS--LKFSLIIYSTVFWLIGGLVLSVGIYAEAER-------QKYKT 54

  Fly    85 FYDVFLNISLVMILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQY 149
            ....||..::::||.|.|:|:|||.|.:.:||:|..||:.:...|.|..::|:...||..:....
  Rat    55 LESAFLAPAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMFILGLCLVMELIGGIVALIFRNQ 119

  Fly   150 MNTFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGV 214
            ...||.... .:.|.:|.||.|.:|.:||.|::|||||  ...|:|||||:|.:||:|....|||
  Rat   120 TIDFLNDNI-RRGIENYYDDLDFKNIMDFVQKKFKCCG--GEDYRDWSKNQYHDCSAPGPLACGV 181

  Fly   215 PYSCCI-NATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIA 278
            ||:||| |.||:    ||.||||...:.....|..:|...||...|.:|...|..::||..|||.
  Rat   182 PYTCCIRNTTDV----VNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYSIMAGLLLGIL 242

  Fly   279 LIQLLVIYL 287
            |.|.|.:.|
  Rat   243 LPQFLGVLL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 92/247 (37%)
penumbra_like_LEL 144..267 CDD:239411 49/123 (40%)
Tspan15NP_001108504.1 penumbra_like_LEL 114..231 CDD:239411 49/123 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.