DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:115/269 - (42%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVR-LENFYDVF--LNISLVMILAGTVIF 104
            |||::|:.|.:..:.|.||:..|...|        ..|| :::|.:..  ..:.:.||:.||:|.
  Fly     8 VKYILFIFNLLCSICGILLIVFGALLF--------SKVRNMDDFAEALRTQQVPVTMIILGTIIL 64

  Fly   105 LVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQ------YMNTFLEKQFTHKII 163
            |:|:.||.||:||:..:...||  :|||.|:...:|:|.::..|      .|...:||.:.|:..
  Fly    65 LISWFGCCGAIRESYCMSMTYS--ILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTS 127

  Fly   164 HSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSG 228
            .|        :::|..|...||||  .|||.|::....|            |.|||.:..:    
  Fly   128 RS--------DYMDAIQISMKCCG--RSGYTDYAYQGKF------------PPSCCSDTNN---- 166

  Fly   229 LVNIMCGYGVQNAPVPEATKLIWTSGC-IEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLE 292
                 |.:           :.::..|| :..|..| :.|..:|....|.||.|:.:....|..|.
  Fly   167 -----CRW-----------ETVYRRGCKVTFVEFW-DRNSDIIKYAGLVIAAIEFVGFVFACCLA 214

  Fly   293 GQIELQKSR 301
            ..|...:.|
  Fly   215 NSIRNYRRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 68/261 (26%)
penumbra_like_LEL 144..267 CDD:239411 26/129 (20%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 68/261 (26%)
tetraspanin_LEL 104..188 CDD:239401 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.