DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp42Eb

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:118/260 - (45%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLE---NF--YDVFLN---ISLV 95
            :|...||:::|||.|| :.||:||.:            .||:.|.   ||  :|..:|   |.:.
  Fly     4 LSAMFKYLLYLLNLVF-VAGGILLIV------------VGSIMLSTMGNFTAFDGGVNTQTIPIC 55

  Fly    96 MILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTH 160
            :|:.|:|.|:|:|.||.|.:|||......|::|:|:.|.|::|::|..|.......:.:.|    
  Fly    56 IIVIGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGK---- 116

  Fly   161 KIIHSYRDDPDLQNF-IDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATD 224
            .:..::.::...|.: :|..|..|.|||  |:|||.:..               ||.||      
  Fly   117 AVDKAWDENNAAQGYPMDALQLAFSCCG--NTGYQQYET---------------VPSSC------ 158

  Fly   225 ISSGLVNIMCGYGVQNAPVPEATKLIWTSGC-IEIVRVWAEHNLYVIAGNALGIALIQLLVIYLA 288
                     ||| .....|.||.......|| .|.|..||. |..:|..::|.|||.:|.:..::
  Fly   159 ---------CGY-KDRTKVCEAEIYSQRPGCRQEFVDFWAS-NTDLIRWSSLIIALFELGIFIMS 212

  Fly   289  288
              Fly   213  212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 74/257 (29%)
penumbra_like_LEL 144..267 CDD:239411 29/124 (23%)
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 74/256 (29%)
tetraspanin_LEL 104..191 CDD:239401 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.