DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tspan5

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_006501799.1 Gene:Tspan5 / 56224 MGIID:1928096 Length:311 Species:Mus musculus


Alignment Length:259 Identity:103/259 - (39%)
Similarity:151/259 - (58%) Gaps:14/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FLLNFVFWLFGGLLLGIGVYAFRDKWEDANGS--VRLENFYDVFLNISLVMILAGTVIFLVSFSG 110
            ||:.......|...||||::|:.:|...:|.|  ..|..|..|:|     .::.|.|:|::.|:|
Mouse    63 FLVRIHSHFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWL-----FLVVGGVMFILGFAG 122

  Fly   111 CVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDDPDLQNF 175
            |:||||||||||||:|:.|.:.|.||:...::.||...::...| ..|.:..|.:||||.||||.
Mouse   123 CIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQL-YFFINNNIRAYRDDIDLQNL 186

  Fly   176 IDFAQQEFKCCGLSNSGYQDWSKNEYFNC--SSPSVEKCGVPYSCCINATDISSGLVNIMCGYGV 238
            |||.|:.::|||.  .|..||:.|.||||  |:.|.|:||||:|||  ..|.:..::|..|||..
Mouse   187 IDFTQEYWQCCGA--FGADDWNLNIYFNCTDSNASRERCGVPFSCC--TKDPAEDVINTQCGYDA 247

  Fly   239 QNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQIELQKSRW 302
            :..|..:...:|:|.||:.....|.:.||.::||..:||||:|:..|.||:.|...||..::.|
Mouse   248 RQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 100/250 (40%)
penumbra_like_LEL 144..267 CDD:239411 49/124 (40%)
Tspan5XP_006501799.1 TM4SF9_like_LEL 156..276 CDD:239412 49/124 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.