DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp97E

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:256 Identity:55/256 - (21%)
Similarity:106/256 - (41%) Gaps:55/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLV--MILAGTVIF 104
            |.|..:..||.::.:.|.||:|:||||               ....:..|:.:|  ::..|.::.
  Fly     7 CSKNALIALNILYVMIGFLLIGVGVYA---------------RAASIVTNLPIVGGILACGVILI 56

  Fly   105 LVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDD 169
            .:|..|..||::.:..:|.||.:.|.:.||::.:||..|..    :|:..::||..:   .:...
  Fly    57 CISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLA----VNSEQQQQFAEQ---GWMTV 114

  Fly   170 P-DLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGLVNIM 233
            | ||:..:   |...||||              ||.::||......|      :.:.|..|:|..
  Fly   115 PTDLRKQV---QDSLKCCG--------------FNATAPSTTSVVPP------SNEPSCELINQQ 156

  Fly   234 CGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQ 294
            |   ..::..|:..    ...|..::....::...:..|..:..:..::|.::||:....|
  Fly   157 C---CAHSSEPDCR----CEPCGPLLEDKIDYAFKLCGGLGIFFSFTEVLAVFLARRYRNQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 55/256 (21%)
penumbra_like_LEL 144..267 CDD:239411 22/123 (18%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 52/248 (21%)
tetraspanin_LEL <121..177 CDD:243179 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.