DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp47F

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:275 Identity:71/275 - (25%)
Similarity:126/275 - (45%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFG-GLLLGIGVYAFRDKWEDANGSVRLE--NFYDVF-----LNISLVMILA 99
            :||::|..|.:|.:.| |:|:.              |:|.|.  |.::.|     |...:|:|:.
  Fly     9 IKYVLFAFNVLFAISGLGILIA--------------GAVVLADVNEFNHFVEGRVLAPPIVLIVT 59

  Fly   100 GTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIH 164
            |.:|||::..||.||::|:..||..:::.|.:.|::|:|:.|...|..:.:...::......|..
  Fly    60 GLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR 124

  Fly   165 SYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDW---SKNEYFNCSSPSVEKCGVPYSCC----INA 222
            |..:|....   |..||:..|||:.:..  ||   |.|:            .:|.|||    |::
  Fly   125 SNSEDTMAW---DNIQQKLMCCGVDSPA--DWRTLSANK------------TLPGSCCQPQYIDS 172

  Fly   223 TDISSGLVNIMCGYGVQNAPVPEATK-LIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIY 286
            |          .|:.:::   |...| ..:..||:..::...|.|..::.|..:|||.||:|.|.
  Fly   173 T----------VGHCLES---PALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIV 224

  Fly   287 LAKTLEGQIELQKSR 301
            ||..|...|..::::
  Fly   225 LACYLANSIRQERAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 70/267 (26%)
penumbra_like_LEL 144..267 CDD:239411 26/130 (20%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 70/267 (26%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.