DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp42Er

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:179 Identity:38/179 - (21%)
Similarity:79/179 - (44%) Gaps:33/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFGGLLLGIGVYAF-----RDKWEDANGSVRLENFYDVFLNISLVMILAGTV 102
            ::|:.||.||:..:.|...:.:.|.|.     :|:                 |.:.| .|..|::
  Fly     8 IRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQ-----------------LILGL-YIAVGSI 54

  Fly   103 IFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYR 167
            :||:||.||.||::|:..:...|:..:|:..::.:.:..|      :...|.|...| |:..::.
  Fly    55 VFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFV------FRMHFEEDSIT-KLKQAFA 112

  Fly   168 DDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPY 216
            ...:..:.:...|.:::|||:..  .:|:. :.|....|...::...||
  Fly   113 KQTNTFDAMAEYQTQYQCCGIYK--LKDYG-DAYITVPSSCYDQNDTPY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 38/179 (21%)
penumbra_like_LEL 144..267 CDD:239411 13/73 (18%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 38/179 (21%)
tetraspanin_LEL 93..174 CDD:239401 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.