DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:256 Identity:53/256 - (20%)
Similarity:91/256 - (35%) Gaps:76/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLVMILA-------G 100
            ||.:::.|:.:..|...:|:..|:|.                  .|..|::.:..|.       |
  Fly     7 VKLIVYALDVLCTLLALVLISFGIYV------------------AVSYNLNEIGQLTAYGYVGLG 53

  Fly   101 TVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIH- 164
            ....||...|.:.|.|||        :|..:.|::.:.:.|:......|:....||.....:.: 
  Fly    54 AAALLVVLWGYLSAWREN--------VCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANA 110

  Fly   165 ---SYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDIS 226
               ::.::.:....:...|..|:|||..:.  ||:..||            .:|...|....|.|
  Fly   111 LEATWEEELNSPGAMSLYQNWFQCCGRGSP--QDYIVNE------------RLPPETCFRNHDKS 161

  Fly   227 SGLVNIMCGYGVQNAPVPEATKLIWTSGC-IEIVRVWAEHNLYVIAGNALGIALI--QLLV 284
            .                ||  .||.| || :|....| :|...:.  |.|.:.||  :||:
  Fly   162 K----------------PE--NLIHT-GCRVEFENYW-QHLTKIF--NILALVLIGFELLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 53/256 (21%)
penumbra_like_LEL 144..267 CDD:239411 26/127 (20%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 53/256 (21%)
tetraspanin_LEL 103..181 CDD:239401 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.