DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:120/265 - (45%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFGGLLLGIG---VYAFRDKWEDANGSVRLENFYDVFLNISLVMILAGTVIF 104
            |||::|:.|.:|.:.|.||:..|   |...:|  ....|.....|      ::::::::.|.|:|
  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKD--FSGVGETFTAN------SVAIIILVLGCVVF 64

  Fly   105 LVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDD 169
            ||:|.||.||:|||:..|..||:.:|:..:.::|:.|..:|....:...||     ||:.:..|.
  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLE-----KIVQTIWDQ 124

  Fly   170 PDLQNFI-DFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPY--SCCINATDISSGLVN 231
            ......: |..|:.||||||  :|:.|:                |:.|  |||.:.::.:..|..
  Fly   125 RKTDALLMDTLQRSFKCCGL--NGFADY----------------GITYPASCCDSPSNGTCALTQ 171

  Fly   232 IMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQIE 296
            :|.                 .|.|::.|..:.:.|:.:|....||:..::|:....|..|..|..
  Fly   172 VMT-----------------RSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTR 219

  Fly   297 LQKSR 301
            ..:.|
  Fly   220 NSQRR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 66/257 (26%)
penumbra_like_LEL 144..267 CDD:239411 26/125 (21%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 66/256 (26%)
tetraspanin_LEL 104..189 CDD:239401 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.