DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and Tspan10

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_663338.2 Gene:Tspan10 / 208634 MGIID:2384781 Length:332 Species:Mus musculus


Alignment Length:258 Identity:90/258 - (34%)
Similarity:128/258 - (49%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDK------WEDANGSVRLENFYDVFLNISLVMIL 98
            |.||||:|||.||:|.|...|.|..|::....|      |   .|.|..:..        |:::|
Mouse    72 SNCVKYLIFLSNFLFSLPSLLALAAGLWGLTVKRSQGIGW---GGPVPTDPM--------LMLVL 125

  Fly    99 AGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKII 163
            .|.|:.:||.|||:||..||:.||.:|...:|....||....::.....:.:...|:......||
Mouse   126 GGLVVSVVSLSGCLGAFCENSCLLHWYCGAVLFCLALEALAGVLMVTLWKPLQDSLKYTLHAAII 190

  Fly   164 HSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSG 228
            | |.|||||...:|..|...:|||..:  ||||.:|.|||||||.|:.|.:|.|||||..: ...
Mouse   191 H-YWDDPDLHFLLDQVQLGLQCCGAVS--YQDWQQNLYFNCSSPGVQACSLPASCCINPQE-DGA 251

  Fly   229 LVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTL 291
            :||..||:|........|.::::..||...::.|...|...|...|:.:.:||...:.||..|
Mouse   252 VVNTQCGFGALGLDQNVAGQVVFLQGCWPALQEWLRGNTGAIGDCAVAVVMIQGTELLLAACL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 89/256 (35%)
penumbra_like_LEL 144..267 CDD:239411 44/122 (36%)
Tspan10NP_663338.2 Tetraspannin 74..304 CDD:278750 84/244 (34%)
oculospanin_like_LEL 171..290 CDD:239420 44/122 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.