DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and tsp-1

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_498804.1 Gene:tsp-1 / 192096 WormBaseID:WBGene00006627 Length:244 Species:Caenorhabditis elegans


Alignment Length:218 Identity:40/218 - (18%)
Similarity:82/218 - (37%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKYMIFLLNFVFWLFGGLLLGIGVYAFRD------------KWEDANGSVRLENFYDVFLNISLV 95
            ::.::|.|:....|....|:.:|.:...|            |::|.      ::..|...||.:.
 Worm     8 IRSVLFFLDLAMLLAALALIAVGFWMGYDSSFDTDLKNVIYKYDDP------KSLADAKFNIRVW 66

  Fly    96 MILAGTVIFLVSFSGCVGAL---------RENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYM- 150
            :|:....|..:|....|.|:         :...|::. |.:.:::...||:...:...|....: 
 Worm    67 LIVVFWSIIGLSLGAVVTAVLGMISSVWPKRKGFMIT-YLVLIIVLVSLEIGCGVAVLVRRNSLH 130

  Fly   151 ---NTFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFN---CSSPSV 209
               |:.::..:|...:          |.:...|.::.|||:.||         .||   | .|..
 Worm   131 DNTNSLIDAMYTTNSV----------NDLKIIQDKYNCCGIENS---------LFNVMYC-GPMS 175

  Fly   210 EK--CGVPYSCCINATDISSGLV 230
            :|  |.|.....::.|.:.||::
 Worm   176 QKPHCDVAVFDSVDNTMMISGII 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 40/218 (18%)
penumbra_like_LEL 144..267 CDD:239411 20/96 (21%)
tsp-1NP_498804.1 Tetraspannin 29..>163 CDD:278750 24/150 (16%)
DUF805 66..>131 CDD:294752 10/65 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.