DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and tsp-3

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_499724.1 Gene:tsp-3 / 192059 WormBaseID:WBGene00006629 Length:223 Species:Caenorhabditis elegans


Alignment Length:163 Identity:35/163 - (21%)
Similarity:68/163 - (41%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRL------ENFYDVFLNISLVMILAGTV 102
            :..:|.||....|.|..::.:.::...||..::.....:      |....|..:|...:|::..:
 Worm     9 RIFLFFLNLAQTLVGFTVIALTLWIRFDKGFESEIRTNILRDNDPEPLAGVKSDIRTGIIVSFWI 73

  Fly   103 IF-------LVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTH 160
            |.       ::.|.|.:||:..:.:||..|.:.:::.||||:||.|...|         :::...
 Worm    74 IIGFAIANVIIGFVGVIGAVIRSKYLLAPYFLFMVILFLLEIAIGITVLV---------KRRSVR 129

  Fly   161 KIIHSYRDDP---DLQNFIDFAQQEFKCCGLSN 190
            :.:..|..|.   :.|..|......:.|||..|
 Worm   130 RTVKEYVFDSFNMNAQADISAFNFRYNCCGAEN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 35/163 (21%)
penumbra_like_LEL 144..267 CDD:239411 9/50 (18%)
tsp-3NP_499724.1 Tetraspannin 9..208 CDD:278750 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.