DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp3A and tspan15

DIOPT Version :9

Sequence 1:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001017773.1 Gene:tspan15 / 100000710 ZFINID:ZDB-GENE-050417-295 Length:296 Species:Danio rerio


Alignment Length:273 Identity:98/273 - (35%)
Similarity:140/273 - (51%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSQCVKYMIFLLNF-------VFWLFGGLLLGIGVYA--FRDKWEDANGSVRLENFYDVFLNISL 94
            |..|.|...|.|.|       :|||.||.:|.||:||  .|.:::...|         |||..::
Zfish     5 VRYCEKCSYFFLKFSLIGYATIFWLIGGFILAIGIYAEVERQRYKTLEG---------VFLAPAI 60

  Fly    95 VMILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFT 159
            ::|:.|.::|:|||.|.:.:||:|..|||.:...|.|..:||:...||..:........|.|...
Zfish    61 ILIVLGIIMFIVSFIGVLASLRDNLCLLKVFLYMLALCLVLELVGGIVALIFKNQTVDILNKNIR 125

  Fly   160 HKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATD 224
            ..:: :|.||.|.:|.:||.|:.|||||  .:.||||..|.|.|||:|....|..||:|||    
Zfish   126 KGMV-NYYDDLDFKNIMDFVQKTFKCCG--GTEYQDWEVNMYHNCSAPGPLACAAPYTCCI---- 183

  Fly   225 ISSG-LVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVI--- 285
            ::.| :||.||||...|....|.|.:|:..||.:.|.:|...|...:||..|||.|.|...:   
Zfish   184 VTPGEVVNTMCGYKTLNKDRHENTDVIYIRGCTDAVFIWLIDNYKTMAGLLLGIFLPQFFGVIFT 248

  Fly   286 --YLAKTLEGQIE 296
              |:.: :|..||
Zfish   249 WLYITR-VEDAIE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 95/267 (36%)
penumbra_like_LEL 144..267 CDD:239411 46/123 (37%)
tspan15NP_001017773.1 Tetraspannin 16..252 CDD:278750 90/251 (36%)
MgtE <54..>113 CDD:280023 22/58 (38%)
penumbra_like_LEL 110..227 CDD:239411 46/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.