DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and GBP2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_009916.1 Gene:GBP2 / 850346 SGDID:S000000517 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:54/254 - (21%)
Similarity:85/254 - (33%) Gaps:79/254 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSK 78
            :||||:.|......:|          .|..:|:..:.:.|:. ..:|..:.:..|.  .:|...|
Yeast   249 DVELDFNGFSRGFGSV----------IYPTEDEMIRAIDTFN-GMEVEGRVLEVRE--GRFNKRK 300

  Fly    79 NDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDT 143
            |     |.:.....|::        ||.:..:|                          |.|.| 
Yeast   301 N-----NDRYNQRREDL--------EDTRGTEP--------------------------GLAQD- 325

  Fly   144 NMMEKKASAAAAAAVD--APKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEE 206
                      ||..:|  |.|..:.|.|             |.|....|..|||..|...:||.:
Yeast   326 ----------AAVHIDETAAKFTEGVNP-------------GGDRNCFIYCSNLPFSTARSDLFD 367

  Fly   207 LVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSK 265
            |...||..:...|...:| |...|.|.|.::...||...|:.||.:.|....|.:.:::
Yeast   368 LFGPIGKINNAELKPQEN-GQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYAR 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 14/109 (13%)
RRM <161..>269 CDD:223796 28/105 (27%)
RRM_eIF3G_like 189..265 CDD:240854 23/75 (31%)
GBP2NP_009916.1 RRM1_HRB1_GBP2 121..197 CDD:410184
RRM2_HRB1_GBP2 218..292 CDD:410185 10/53 (19%)
RRM3_HRB1_GBP2 347..425 CDD:410186 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.