DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Y14

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:161 Identity:35/161 - (21%)
Similarity:66/161 - (40%) Gaps:42/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGA---------------------------- 178
            :.::|:::.:|...|.| :|::|.   |.||.:..||                            
plant    15 EDDLMDEEGTAIDGADV-SPRAGH---PRLKSAIAGANGESAKKTKGRGFREEKDSDRQRRLSSR 75

  Fly   179 ----LGMRGRD------DTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAY 233
                ||..||.      :...|.:|.:.|...|.|:.......|....:.|..|:.:|..||:|.
plant    76 DFESLGSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYAL 140

  Fly   234 VHFKQRKDAAAAIEILNGHGYDHLILSVEWS 264
            :.::::::|.:||..:||.......:||:|:
plant   141 IEYEKKEEAQSAISAMNGAELLTQNVSVDWA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 31/142 (22%)
RRM_eIF3G_like 189..265 CDD:240854 20/76 (26%)
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 20/83 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.