DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AT5G59860

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_200794.1 Gene:AT5G59860 / 836108 AraportID:AT5G59860 Length:157 Species:Arabidopsis thaliana


Alignment Length:190 Identity:44/190 - (23%)
Similarity:68/190 - (35%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KPGPNSQT--TMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDT 143
            |..|..:|  .:|:.||.:.|.|.|                          |.   |:|.     
plant     2 KADPRKETGIKLVAVEISLTFGNRK--------------------------WQ---PHKN----- 32

  Fly   144 NMMEKKASAAAAAAVDAPKSGKY---VPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLE 205
                   |.|........|..||   :.|....|::..|  .|......:..|.||...|:..|.
plant    33 -------SGAKDEEAKFNKRTKYKMRIRPRSSISKRRRL--IGGKTLTCVSNSGLSAYTTDQSLR 88

  Fly   206 ELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSK 265
            :|   ..|.::  |.:|:.|...|||.::.|:...||..|::.|||...:..::.||.:|
plant    89 QL---FAPFAR--LIKDQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 12/60 (20%)
RRM <161..>269 CDD:223796 30/108 (28%)
RRM_eIF3G_like 189..265 CDD:240854 22/75 (29%)
AT5G59860NP_200794.1 RRM 2..>157 CDD:223796 44/190 (23%)
RRM 76..139 CDD:214636 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.