DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AT5G51300

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001032055.1 Gene:AT5G51300 / 835204 AraportID:AT5G51300 Length:804 Species:Arabidopsis thaliana


Alignment Length:171 Identity:42/171 - (24%)
Similarity:71/171 - (41%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KNIAKCRIC-NGEHWSVNCPYKGTA---MDT-----------NMMEKKASAAAAAAVDAPKSGKY 166
            |:...|:|| :|.|.:::||.|||.   ||.           .:.|.....:|..|:....||..
plant   384 KSDVLCKICGDGGHPTIDCPVK
GTTGKKMDDEYQNFLAELGGTVPESSLKQSATLALGPGSSGSN 448

  Fly   167 VPPFLKDSQKGALGMRGRDDTAA-----------IRISNLSESMTEADLEELVKKIGPQSKMYLA 220
             ||:..::..||....|...|..           :.|..|...:.:..|..|....|......:.
plant   449 -PPWANNAGNGASAHPGLGSTPTKPPSKEYDETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVI 512

  Fly   221 RDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSV 261
            :|:.|||.||:.:|.:...:.|..|::.:||:.::...|:|
plant   513 KDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAV 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 10/23 (43%)
RRM <161..>269 CDD:223796 26/112 (23%)
RRM_eIF3G_like 189..265 CDD:240854 18/84 (21%)
AT5G51300NP_001032055.1 SF1-HH 126..237 CDD:318504
SF1_like-KH 242..358 CDD:239088
AIR1 <363..405 CDD:331526 8/20 (40%)
RRM_SF 480..556 CDD:327398 18/74 (24%)
RRM <481..673 CDD:330708 18/73 (25%)
Atrophin-1 <579..>791 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.