DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AT5G41690

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001332758.1 Gene:AT5G41690 / 834172 AraportID:AT5G41690 Length:567 Species:Arabidopsis thaliana


Alignment Length:269 Identity:59/269 - (21%)
Similarity:100/269 - (37%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LPPTTETVENGQKYVTEYK-YNKDDKKTKVVRTYKISKQVVPKT-------VAKRRTWTKFG--- 75
            |||         ||..::| ::||.::   :.::.|.:...|..       ||.....||..   
plant   150 LPP---------KYCIDHKVWDKDYRR---LESHPIEEDERPPNSVEEVLFVANLSPQTKISDIF 202

  Fly    76 DSKNDKPGPNSQTTMVSEE------IIMQFLNSKEDEKA----NDPLLDPTK---NIAKCRICNG 127
            |..|......|...||:.|      ..::|.::.|.:||    |...|...|   ::||      
plant   203 DFFNCVGEVVSIRLMVNHEGKHVGYGFVEFASADETKKALENKNGEYLHDHKIFIDVAK------ 261

  Fly   128 EHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPP-FLKDSQKGALGMRGRDDTAAIR 191
                 ..||. .....|::||............|......|| |::     |:|:|.:    .:.
plant   262 -----TAPYP-PGPKYNLVEKLCYEDYLRRESLPIDEDETPPEFVE-----AVGVRKK----TLF 311

  Fly   192 ISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDH 256
            :::||.......:....|.:|....:.|..: :||...|.|:|.|....:|..|:|..||...:.
plant   312 VAHLSRKTEITHIINFFKDVGEVVHVRLILN-HTGKHVGCAFVEFGSANEAKMALETKNGEYLND 375

  Fly   257 LILSVEWSK 265
            ..:.:|.:|
plant   376 CKIFLEVAK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 28/133 (21%)
RRM <161..>269 CDD:223796 25/106 (24%)
RRM_eIF3G_like 189..265 CDD:240854 17/75 (23%)
AT5G41690NP_001332758.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.