DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AT5G09880

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_568220.1 Gene:AT5G09880 / 830848 AraportID:AT5G09880 Length:527 Species:Arabidopsis thaliana


Alignment Length:280 Identity:62/280 - (22%)
Similarity:98/280 - (35%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ENG----QKYVTEYKYNKD-DKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKNDKP------- 82
            |||    .:....::.::| |::...||.....|:...:..:|.|     ..|..|||       
plant    67 ENGGGKRDRERERHRSSRDKDRERDKVREGSRDKESDRERSSKER-----DRSDRDKPRDRERRE 126

  Fly    83 -----GPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGT--- 139
                 ...|:......|::.:......|:| ::|..||.::       ....::...|.|.|   
plant   127 REKRSSSRSRREEKEPEVVERGSRRHRDKK-DEPEADPERD-------QRTVFAYQMPLKATERD 183

  Fly   140 ----------------AMDTNMMEKKA----------SAAAAAAVDAPKSGK-------YVPPF- 170
                            .||.|....|.          |...|.|:    ||:       .|.|. 
plant   184 VYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYDVMSVPMAIAL----SGQLFLGQPVMVKPSE 244

  Fly   171 ----LKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGF 231
                |..|....:|..|..| ..:.:.||..:|:|..|.::.:..||...:.|..|..||.||||
plant   245 AEKNLAQSNSTTVGGTGPAD-RKLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGF 308

  Fly   232 AYVHFKQRKDAAAAIEILNG 251
            .::.|.|.:.:.||...|||
plant   309 GFIQFVQLEHSKAAQIALNG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 24/145 (17%)
RRM <161..>269 CDD:223796 31/103 (30%)
RRM_eIF3G_like 189..265 CDD:240854 22/63 (35%)
AT5G09880NP_568220.1 SF-CC1 85..517 CDD:273721 59/262 (23%)
RRM1_RBM39_like 169..241 CDD:240729 12/75 (16%)
RRM2_RBM23_RBM39 267..340 CDD:240730 22/62 (35%)
RBM39linker 366..452 CDD:292157
RRM3_RBM39_like 434..517 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.