DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and EIF3G2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_196219.3 Gene:EIF3G2 / 830487 AraportID:AT5G06000 Length:308 Species:Arabidopsis thaliana


Alignment Length:284 Identity:100/284 - (35%)
Similarity:157/284 - (55%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETIKSSWA--DEVELDYGGLPPTTETV---ENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKT 64
            :|.|..|.  ||.|.||..|.|..:.:   :||.|.|.|||:|::|||.|:..|.::.|:.:.|.
plant     8 KTKKLRWGEIDEEEGDYDFLLPPKQMISPDQNGVKKVIEYKFNEEDKKVKITTTTRVQKRALTKQ 72

  Fly    65 VAKRRTWTKFGDSKNDKPGPNSQTTMVS-EEIIMQFL-----NSKEDEKANDPLLD---PTKNIA 120
            ..:||:|.||||:.:::  .:|..||.| |:||::.:     |:::...:.|.:..   |...:.
plant    73 AVERRSWNKFGDAAHEE--SSSYLTMRSTEDIILERIRAPGSNAEQSTVSGDSMSQLGKPGAVLM 135

  Fly   121 KCRIC--NGEHWSVNCPYKG--TAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLK---DSQKGA 178
            .||:|  .|:||:..||.|.  :.||    |...:..:.:.:.......||||.::   |.:.|.
plant   136 VCRLCQKKGDHWTSRCPQKDLLSLMD----EPLTAETSTSTITGTGRAAYVPPSMREGADRKAGG 196

  Fly   179 LGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAA 243
            ..||.|.|..::|::||||.....||.||.:..|..::.::|.|:.|.:.:||.:|.|..|:||.
plant   197 SDMRSRHDENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQ 261

  Fly   244 AAIEILNGHGYDHLILSVEWSKPQ 267
            .||..|||:|||:|||.||||.|:
plant   262 RAINKLNGYGYDNLILRVEWSTPK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 41/122 (34%)
RRM <161..>269 CDD:223796 46/110 (42%)
RRM_eIF3G_like 189..265 CDD:240854 34/75 (45%)
EIF3G2NP_196219.3 eIF3g 36..157 CDD:289149 41/122 (34%)
RRM <187..>287 CDD:223796 42/99 (42%)
RRM_eIF3G_like 207..282 CDD:240854 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3145
eggNOG 1 0.900 - - E1_KOG0122
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I1585
OMA 1 1.010 - - QHG55427
OrthoDB 1 1.010 - - D1226059at2759
OrthoFinder 1 1.000 - - FOG0003558
OrthoInspector 1 1.000 - - mtm1122
orthoMCL 1 0.900 - - OOG6_102687
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2433
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.